FANCL Antikörper (Middle Region)

Produktnummer ABIN631983

Der Kaninchen Polyklonal anti-FANCL Antikörper (ABIN631983) detektiert spezifisch FANCL in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für FANCL Antikörper (Middle Region) (ABIN631983)

Target: FANCL (Fanconi Anemia, Complementation Group L (FANCL))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FANCL Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-FANCL Antikörper

Bindungsspezifität: Middle Region

Spezifität: FANCL antibody was raised against the middle region of FANCL

Aufreinigung: Affinity purified

Immunogen: FANCL antibody was raised using the middle region of FANCL corresponding to a region with amino acids ASGREHLITLKLKAKYPAESPDYFVDFPVPFCASWTPQVNSPQSSLISIY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FANCL Blocking Peptide, (ABIN936892), is also available for use as a blocking control in assays to test for specificity of this FANCL antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FANCL antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FANCL

Target: FANCL (Fanconi Anemia, Complementation Group L (FANCL))

Andere Bezeichnung: FANCL

Hintergrund: The Fanconi anemia complementation group (FANC) currently includes FANCA, FANCB, FANCC, FANCD1 (also called BRCA2), FANCD2, FANCE, FANCF, FANCG, FANCI, FANCJ (also called BRIP1), FANCL, FANCM and FANCN (also called PALB2). The previously defined group FANCH is the same as FANCA. Fanconi anemia is a genetically heterogeneous recessive disorder characterized by cytogenetic instability, hypersensitivity to DNA crosslinking agents, increased chromosomal breakage, and defective DNA repair.

Molekulargewicht: 42 kDa (MW of target protein)

Pathways: DNA Reparatur