ADH5 Antikörper

Produktnummer ABIN631955

Produktdetails anti-ADH5 Antikörper

Target: ADH5 (Alcohol Dehydrogenase 5 (Class III), chi Polypeptide (ADH5))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ADH5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: ADH5 antibody was raised using a synthetic peptide corresponding to a region with amino acids KSVESVPKLVSEYMSKKIKVDEFVTHNLSFDEINKAFELMHSGKSIRTVV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ADH5 Blocking Peptide, catalog no. 33R-4667, is also available for use as a blocking control in assays to test for specificity of this ADH5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADH5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ADH5

Target: ADH5 (Alcohol Dehydrogenase 5 (Class III), chi Polypeptide (ADH5))

Andere Bezeichnung: ADH5 (ADH5 Produkte)

Synonyme: ADH2 antikoerper, ADH-3 antikoerper, ADHX antikoerper, FALDH antikoerper, FDH antikoerper, GSH-FDH antikoerper, GSNOR antikoerper, ADH1C antikoerper, ADH3 antikoerper, wu:fb60b11 antikoerper, Adh-5 antikoerper, Adh3 antikoerper, adh-3 antikoerper, adh3 antikoerper, adh5 antikoerper, adhx antikoerper, fdh antikoerper, gsnor antikoerper, ADH4 antikoerper, ADH5 antikoerper, alcohol dehydrogenase 1B (class I), beta polypeptide antikoerper, alcohol dehydrogenase 5 (class III), chi polypeptide antikoerper, alcohol dehydrogenase 5 antikoerper, alcohol dehydrogenase 5 (class III), chi polypeptide L homeolog antikoerper, alcohol dehydrogenase class-3 antikoerper, ADH1B antikoerper, ADH5 antikoerper, adh5 antikoerper, Adh5 antikoerper, adh5.L antikoerper, LOC101112223 antikoerper

Hintergrund: This gene encodes a member of the alcohol dehydrogenase family. Members of this family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. The encoded protein forms a homodimer. It has virtually no activity for ethanol oxidation, but exhibits high activity for oxidation of long-chain primary alcohols and for oxidation of S-hydroxymethyl-glutathione, a spontaneous adduct between formaldehyde and glutathione. This enzyme is an important component of cellular metabolism for the elimination of formaldehyde, a potent irritant and sensitizing agent that causes lacrymation, rhinitis, pharyngitis, and contact dermatitis. The human genome contains several non-transcribed pseudogenes related to this gene.

Molekulargewicht: 40 kDa (MW of target protein)