NMRAL1 Antikörper (Middle Region)
-
- Target Alle NMRAL1 Antikörper anzeigen
- NMRAL1 (NmrA-Like Family Domain Containing 1 (NMRAL1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser NMRAL1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- NMRAL1 antibody was raised against the middle region of NMRAL1
- Aufreinigung
- Affinity purified
- Immunogen
- NMRAL1 antibody was raised using the middle region of NMRAL1 corresponding to a region with amino acids TCRHTAEEYAALLTKHTRKVVHDAKMTPEDYEKLGFPGARDLANMFRFYA
- Top Product
- Discover our top product NMRAL1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
NMRAL1 Blocking Peptide, catalog no. 33R-8999, is also available for use as a blocking control in assays to test for specificity of this NMRAL1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NMRAL1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NMRAL1 (NmrA-Like Family Domain Containing 1 (NMRAL1))
- Andere Bezeichnung
- NMRAL1 (NMRAL1 Produkte)
- Synonyme
- HSCARG antikoerper, SDR48A1 antikoerper, 1110025F24Rik antikoerper, AI256624 antikoerper, RGD1311451 antikoerper, NmrA like redox sensor 1 antikoerper, NmrA-like family domain containing 1 antikoerper, NMRAL1 antikoerper, Nmral1 antikoerper
- Hintergrund
- The function of this protein is binding, oxidoreductase activity and transcription repressor activity.
- Molekulargewicht
- 33 kDa (MW of target protein)
-