NMRAL1 Antikörper (Middle Region)

Produktnummer ABIN631947

Dieses Anti-NMRAL1-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von NMRAL1 in WB. Geeignet für Human.

Kurzübersicht für NMRAL1 Antikörper (Middle Region) (ABIN631947)

Target: NMRAL1 (NmrA-Like Family Domain Containing 1 (NMRAL1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NMRAL1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-NMRAL1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: NMRAL1 antibody was raised against the middle region of NMRAL1

Aufreinigung: Affinity purified

Immunogen: NMRAL1 antibody was raised using the middle region of NMRAL1 corresponding to a region with amino acids TCRHTAEEYAALLTKHTRKVVHDAKMTPEDYEKLGFPGARDLANMFRFYA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NMRAL1 Blocking Peptide, (ABIN5615011), is also available for use as a blocking control in assays to test for specificity of this NMRAL1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NMRAL1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NMRAL1

Target: NMRAL1 (NmrA-Like Family Domain Containing 1 (NMRAL1))

Andere Bezeichnung: NMRAL1

Hintergrund: The function of this protein is binding, oxidoreductase activity and transcription repressor activity.

Molekulargewicht: 33 kDa (MW of target protein)