PARP12 Antikörper
-
- Target Alle PARP12 Produkte
- PARP12 (Poly (ADP-Ribose) Polymerase Family, Member 12 (PARP12))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PARP12 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- PARP12 antibody was raised using a synthetic peptide corresponding to a region with amino acids FYDSCVNSVSDPSIFVIFEKHQVYPEYVIQYTTSSKPSVTPSILLALGSL
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PARP12 Blocking Peptide, catalog no. 33R-3134, is also available for use as a blocking control in assays to test for specificity of this PARP12 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PARP12 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PARP12 (Poly (ADP-Ribose) Polymerase Family, Member 12 (PARP12))
- Andere Bezeichnung
- PARP12 (PARP12 Produkte)
- Synonyme
- ARTD12 antikoerper, MST109 antikoerper, MSTP109 antikoerper, ZC3H1 antikoerper, ZC3HDC1 antikoerper, 9930021O16 antikoerper, AA409132 antikoerper, AA536654 antikoerper, PARP-12 antikoerper, Zc3hdc1 antikoerper, PARP12 antikoerper, zc3h1 antikoerper, mst109 antikoerper, mstp109 antikoerper, zc3hdc1 antikoerper, si:ch211-227d19.2 antikoerper, poly(ADP-ribose) polymerase family member 12 antikoerper, poly (ADP-ribose) polymerase family, member 12 antikoerper, poly(ADP-ribose) polymerase family member 12 L homeolog antikoerper, poly (ADP-ribose) polymerase family, member 12a antikoerper, poly [ADP-ribose] polymerase 12 antikoerper, PARP12 antikoerper, Parp12 antikoerper, parp12.L antikoerper, parp12a antikoerper, parp12 antikoerper, LOC100561568 antikoerper
- Hintergrund
- The function of PARP12 protein is not widely studied, and is yet to be elucidated fully.
- Molekulargewicht
- 79 kDa (MW of target protein)
-