PARP12 Antikörper

Produktnummer ABIN631944

Der Kaninchen Polyklonal anti-PARP12 Antikörper (ABIN631944) detektiert spezifisch PARP12 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für PARP12 Antikörper (ABIN631944)

Target: PARP12 (Poly (ADP-Ribose) Polymerase Family, Member 12 (PARP12))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PARP12 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PARP12 Antikörper

Aufreinigung: Affinity purified

Immunogen: PARP12 antibody was raised using a synthetic peptide corresponding to a region with amino acids FYDSCVNSVSDPSIFVIFEKHQVYPEYVIQYTTSSKPSVTPSILLALGSL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PARP12 Blocking Peptide, (ABIN938520), is also available for use as a blocking control in assays to test for specificity of this PARP12 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PARP12 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PARP12

Target: PARP12 (Poly (ADP-Ribose) Polymerase Family, Member 12 (PARP12))

Andere Bezeichnung: PARP12

Hintergrund: The function of PARP12 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 79 kDa (MW of target protein)