LRRC50 Antikörper (N-Term)

Produktnummer ABIN631930

Produktdetails anti-LRRC50 Antikörper

Target: LRRC50 (Leucine Rich Repeat Containing 50 (LRRC50))

Bindungsspezifität: N-Term

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LRRC50 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: LRRC50 antibody was raised against the N terminal of LRRC50

Aufreinigung: Affinity purified

Immunogen: LRRC50 antibody was raised using the N terminal of LRRC50 corresponding to a region with amino acids LNDTLYLHFKGFDRIENLEEYTGLRCLWLQSNGIQKIENLEAQTELRCLF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LRRC50 Blocking Peptide, catalog no. 33R-5219, is also available for use as a blocking control in assays to test for specificity of this LRRC50 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRC50 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LRRC50

Target: LRRC50 (Leucine Rich Repeat Containing 50 (LRRC50))

Andere Bezeichnung: LRRC50 (LRRC50 Produkte)

Synonyme: 4930457P18Rik antikoerper, Lrrc50 antikoerper, LRRC50 antikoerper, CILD13 antikoerper, ODA7 antikoerper, LLRC50 antikoerper, RGD1310542 antikoerper, lrrc50 antikoerper, zgc:56169 antikoerper, dynein, axonemal assembly factor 1 antikoerper, dynein axonemal assembly factor 1 antikoerper, dynein, axonemal, assembly factor 1 antikoerper, Dnaaf1 antikoerper, DNAAF1 antikoerper, dnaaf1 antikoerper

Hintergrund: LRRC50 contains 6 LRR (leucine-rich) repeats. It is proposed that LRRC50 to be a novel candidate gene for human cystic kidney disease, involved in regulation of microtubule-based cilia and actin-based brush border microvilli.

Molekulargewicht: 80 kDa (MW of target protein)