PFDN6 Antikörper (N-Term)

Produktnummer ABIN631922

Produktdetails anti-PFDN6 Antikörper

Target: PFDN6 (Prefoldin Subunit 6 (PFDN6))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PFDN6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PFDN6 antibody was raised against the N terminal of PFDN6

Aufreinigung: Affinity purified

Immunogen: PFDN6 antibody was raised using the N terminal of PFDN6 corresponding to a region with amino acids MAELIQKKLQGEVEKYQQLQKDLSKSMSGRQKLEAQLTENNIVKEELALL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PFDN6 Blocking Peptide, catalog no. 33R-5640, is also available for use as a blocking control in assays to test for specificity of this PFDN6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PFDN6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PFDN6

Target: PFDN6 (Prefoldin Subunit 6 (PFDN6))

Andere Bezeichnung: PFDN6 (PFDN6 Produkte)

Synonyme: hke2 antikoerper, ke-2 antikoerper, pfd6 antikoerper, h2-ke2 antikoerper, pfdn6a antikoerper, 23.m05913 antikoerper, H-2Ke2 antikoerper, Ke-2 antikoerper, Pfdn6 antikoerper, H2-KE2 antikoerper, HKE2 antikoerper, KE-2 antikoerper, PFD6 antikoerper, zgc:66282 antikoerper, pfdn6 antikoerper, pfdn6b antikoerper, Ke2 antikoerper, prefoldin subunit 6 S homeolog antikoerper, prefoldin subunit 6 (predicted) antikoerper, prefoldin subunit 6 antikoerper, prefoldin subunit 6 L homeolog antikoerper, pfdn6.S antikoerper, SPAC3A11.13 antikoerper, BBOV_IV004800 antikoerper, AOR_1_2254174 antikoerper, CMU_042830 antikoerper, pfdn6 antikoerper, Pfdn6 antikoerper, PFDN6 antikoerper, pfdn6.L antikoerper

Hintergrund: PFDN6 binds specifically to cytosolic chaperonin (c-CPN) and transfers target proteins to it. PFDN6 binds to nascent polypeptide chain and promotes folding in an environment in which there are many competing pathways for nonnative proteins.

Molekulargewicht: 14 kDa (MW of target protein)

Pathways: Unfolded Protein Response