PFDN6 Antikörper (N-Term)

Produktnummer ABIN631922

Der Kaninchen Polyklonal Anti-PFDN6-Antikörper wurde für WB validiert. Er ist geeignet, PFDN6 in Proben von Human, Maus, Ratte und Hund zu detektieren.

Kurzübersicht für PFDN6 Antikörper (N-Term) (ABIN631922)

Target: PFDN6 (Prefoldin Subunit 6 (PFDN6))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PFDN6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PFDN6 Antikörper

Bindungsspezifität: N-Term

Spezifität: PFDN6 antibody was raised against the N terminal of PFDN6

Aufreinigung: Affinity purified

Immunogen: PFDN6 antibody was raised using the N terminal of PFDN6 corresponding to a region with amino acids MAELIQKKLQGEVEKYQQLQKDLSKSMSGRQKLEAQLTENNIVKEELALL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PFDN6 Blocking Peptide, catalog no. 33R-5640, is also available for use as a blocking control in assays to test for specificity of this PFDN6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PFDN6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PFDN6

Target: PFDN6 (Prefoldin Subunit 6 (PFDN6))

Andere Bezeichnung: PFDN6

Hintergrund: PFDN6 binds specifically to cytosolic chaperonin (c-CPN) and transfers target proteins to it. PFDN6 binds to nascent polypeptide chain and promotes folding in an environment in which there are many competing pathways for nonnative proteins.

Molekulargewicht: 14 kDa (MW of target protein)

Pathways: Unfolded Protein Response