CAPZA3 Antikörper

Produktnummer ABIN631921

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch CAPZA3 in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für CAPZA3 Antikörper (ABIN631921)

Target: CAPZA3 (Capping Protein (Actin Filament) Muscle Z-Line, alpha 3 (CAPZA3))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CAPZA3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-CAPZA3 Antikörper

Aufreinigung: Affinity purified

Immunogen: CAPZA3 antibody was raised using a synthetic peptide corresponding to a region with amino acids MTLSVLSRKDKERVIRRLLLQAPPGEFVNAFDDLCLLIRDEKLMHHQGEC

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CAPZA3 Blocking Peptide, (ABIN5612605), is also available for use as a blocking control in assays to test for specificity of this CAPZA3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CAPZA3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CAPZA3

Target: CAPZA3 (Capping Protein (Actin Filament) Muscle Z-Line, alpha 3 (CAPZA3))

Andere Bezeichnung: CAPZA3

Hintergrund: F-actin-capping proteins bind in a Ca2+-independent manner to the fast growing ends of actin filaments (barbed end) thereby blocking the exchange of subunits at these ends. Unlike other capping proteins (such as gelsolin and severin), these proteins do not sever actin filaments. CAPZA3 may play a role in the morphogenesis of spermatid.

Molekulargewicht: 33 kDa (MW of target protein)

Pathways: Regulation of Actin Filament Polymerization