FANCA Antikörper (N-Term)

Produktnummer ABIN631910

Produktdetails anti-FANCA Antikörper

Target: FANCA (Fanconi Anemia Group A Protein (FANCA))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FANCA Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: FANCA antibody was raised against the N terminal of FANCA

Aufreinigung: Affinity purified

Immunogen: FANCA antibody was raised using the N terminal of FANCA corresponding to a region with amino acids KLSLSKVIDCDSSEAYANHSSSFIGSALQDQASRLGVPVGILSAGMVASS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FANCA Blocking Peptide, catalog no. 33R-4540, is also available for use as a blocking control in assays to test for specificity of this FANCA antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FANCA antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FANCA

Target: FANCA (Fanconi Anemia Group A Protein (FANCA))

Andere Bezeichnung: FANCA (FANCA Produkte)

Synonyme: FA antikoerper, FA-H antikoerper, FA1 antikoerper, FAA antikoerper, FACA antikoerper, FAH antikoerper, FANCH antikoerper, AW208693 antikoerper, Fanconi anemia complementation group A antikoerper, Fanconi anemia, complementation group A antikoerper, FANCA antikoerper, Fanca antikoerper

Hintergrund: The Fanconi anemia complementation group (FANC) currently includes FANCA, FANCB, FANCC, FANCD1 (also called BRCA2), FANCD2, FANCE, FANCF, FANCG, FANCI, FANCJ (also called BRIP1), FANCL, FANCM and FANCN (also called PALB2). The previously defined group FANCH is the same as FANCA. Fanconi anemia is a genetically heterogeneous recessive disorder characterized by cytogenetic instability, hypersensitivity to DNA crosslinking agents, increased chromosomal breakage, and defective DNA repair.

Molekulargewicht: 33 kDa (MW of target protein)

Pathways: DNA Reparatur