ACTR3 Antikörper

Produktnummer ABIN631909

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch ACTR3 in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für ACTR3 Antikörper (ABIN631909)

Target: ACTR3 (ARP3 Actin-Related Protein 3 (ACTR3))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ACTR3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ACTR3 Antikörper

Aufreinigung: Affinity purified

Immunogen: ACTR3 antibody was raised using a synthetic peptide corresponding to a region with amino acids IAIKESAKVGDQAQRRVMKGVDDLDFFIGDEAIEKPTYATKWPIRHGIVE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ACTR3 Blocking Peptide, (ABIN939277), is also available for use as a blocking control in assays to test for specificity of this ACTR3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACTR3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ACTR3

Target: ACTR3 (ARP3 Actin-Related Protein 3 (ACTR3))

Andere Bezeichnung: ACTR3

Hintergrund: The specific function of this gene has not yet been determined, however, the protein it encodes is known to be a major constituent of the ARP2/3 complex. This complex is located at the cell surface and is essential to cell shape and motility through lamellipodial actin assembly and protrusion.

Molekulargewicht: 47 kDa (MW of target protein)

Pathways: RTK Signalweg, Regulation of Actin Filament Polymerization