-
- Target Alle ACTR3 Antikörper anzeigen
- ACTR3 (ARP3 Actin-Related Protein 3 (ACTR3))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ACTR3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- ACTR3 antibody was raised using a synthetic peptide corresponding to a region with amino acids IAIKESAKVGDQAQRRVMKGVDDLDFFIGDEAIEKPTYATKWPIRHGIVE
- Top Product
- Discover our top product ACTR3 Primärantikörper
-
anti-ARP3 Actin-Related Protein 3 (ACTR3) (AA 1-418) antibody
ACTR3 Reaktivität: Human WB, ELISA, IF, IHC (p) Wirt: Maus Monoclonal 2B6 unconjugated
anti-ARP3 Actin-Related Protein 3 (ACTR3) (AA 287-418) antibodyACTR3 Reaktivität: Human WB, ELISA, IHC, FACS Wirt: Maus Monoclonal 3G2C9 unconjugated
anti-ARP3 Actin-Related Protein 3 (ACTR3) (AA 287-418) antibodyACTR3 Reaktivität: Human WB, ELISA, IHC, ICC Wirt: Maus Monoclonal 3G2G1 unconjugated
anti-ARP3 Actin-Related Protein 3 (ACTR3) (AA 1-418) antibodyACTR3 Reaktivität: Human WB, IF Wirt: Kaninchen Polyclonal unconjugated
anti-ARP3 Actin-Related Protein 3 (ACTR3) (AA 380-407), (C-Term) antibodyACTR3 Reaktivität: Human WB, FACS, IHC (p) Wirt: Kaninchen Polyclonal RB20506 unconjugated
anti-ARP3 Actin-Related Protein 3 (ACTR3) (C-Term) antibodyACTR3 Reaktivität: Human, Maus, Ratte WB, ELISA, IHC, IF, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-ARP3 Actin-Related Protein 3 (ACTR3) (AA 352-409) antibodyACTR3 Reaktivität: Human ELISA, IHC, IF Wirt: Kaninchen Polyclonal unconjugated
anti-ARP3 Actin-Related Protein 3 (ACTR3) (C-Term) antibodyACTR3 Reaktivität: Human, Maus, Ratte WB, ELISA, IF, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-ARP3 Actin-Related Protein 3 (ACTR3) antibodyACTR3 Reaktivität: Human WB, IHC, FACS Wirt: Kaninchen Polyclonal unconjugated
anti-ARP3 Actin-Related Protein 3 (ACTR3) (C-Term) antibodyACTR3 Reaktivität: Human WB, ELISA Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ACTR3 Blocking Peptide, catalog no. 33R-3891, is also available for use as a blocking control in assays to test for specificity of this ACTR3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACTR3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ACTR3 (ARP3 Actin-Related Protein 3 (ACTR3))
- Andere Bezeichnung
- ACTR3 (ACTR3 Produkte)
- Hintergrund
- The specific function of this gene has not yet been determined, however, the protein it encodes is known to be a major constituent of the ARP2/3 complex. This complex is located at the cell surface and is essential to cell shape and motility through lamellipodial actin assembly and protrusion.
- Molekulargewicht
- 47 kDa (MW of target protein)
- Pathways
- RTK Signalweg, Regulation of Actin Filament Polymerization
-
Sie sind hier:
