MYL3/CMLC1 Antikörper (N-Term)

Produktnummer ABIN631908

Produktdetails anti-MYL3/CMLC1 Antikörper

Target: MYL3/CMLC1 (MYL3) (Myosin, Light Chain 3 (MYL3))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MYL3/CMLC1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: MYL3 antibody was raised against the N terminal of MYL3

Aufreinigung: Affinity purified

Immunogen: MYL3 antibody was raised using the N terminal of MYL3 corresponding to a region with amino acids VEFDASKIKIEFTPEQIEEFKEAFMLFDRTPKCEMKITYGQCGDVLRALG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MYL3 Blocking Peptide, catalog no. 33R-9494, is also available for use as a blocking control in assays to test for specificity of this MYL3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MYL3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MYL3/CMLC1

Target: MYL3/CMLC1 (MYL3) (Myosin, Light Chain 3 (MYL3))

Andere Bezeichnung: MYL3 (MYL3 Produkte)

Synonyme: CMD1S antikoerper, CMH1 antikoerper, MPD1 antikoerper, MYHCB antikoerper, SPMD antikoerper, SPMM antikoerper, B-MHC antikoerper, MyHC-I antikoerper, Myhc-b antikoerper, Myhcb antikoerper, beta-MHC antikoerper, MLC1s antikoerper, MLC1v antikoerper, Mylc antikoerper, VLC1 antikoerper, Mylc1v antikoerper, CMH8 antikoerper, MLC1SB antikoerper, MLC1V antikoerper, mlc1v antikoerper, myl3-a antikoerper, myl3-b antikoerper, myl3.L antikoerper, zgc:103441 antikoerper, myosin heavy chain 7 antikoerper, myosin, heavy polypeptide 7, cardiac muscle, beta antikoerper, myosin, light polypeptide 3 antikoerper, myosin light chain 3 antikoerper, myosin light chain 3 S homeolog antikoerper, cardiac myosin light chain-1 antikoerper, MYH7 antikoerper, Myh7 antikoerper, Myl3 antikoerper, MYL3 antikoerper, myl3.S antikoerper, cmlc1 antikoerper

Hintergrund: MYL3 encodes myosin light chain 3, an alkali light chain also referred to in the literature as both the ventricular isoform and the slow skeletal muscle isoform.

Molekulargewicht: 22 kDa (MW of target protein)