MAGEA3 Antikörper (Middle Region)

Produktnummer ABIN631907

Produktdetails anti-MAGEA3 Antikörper

Target: MAGEA3 (Melanoma Antigen Family A, 3 (MAGEA3))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MAGEA3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: MAGEA3 antibody was raised against the middle region of MAGEA3

Aufreinigung: Affinity purified

Immunogen: MAGEA3 antibody was raised using the middle region of MAGEA3 corresponding to a region with amino acids APEEKIWEELSVLEVFEGREDSILGDPKKLLTQHFVQENYLEYRQVPGSD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MAGEA3 Blocking Peptide, catalog no. 33R-1420, is also available for use as a blocking control in assays to test for specificity of this MAGEA3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAGEA3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MAGEA3

Target: MAGEA3 (Melanoma Antigen Family A, 3 (MAGEA3))

Andere Bezeichnung: MAGEA3 (MAGEA3 Produkte)

Synonyme: CT1.3 antikoerper, HIP8 antikoerper, HYPD antikoerper, MAGE3 antikoerper, MAGEA6 antikoerper, Mage-a3 antikoerper, MAGEA3 antikoerper, MAGE family member A3 antikoerper, melanoma antigen, family A, 3 antikoerper, melanoma antigen family A, 3 antikoerper, MAGEA3 antikoerper, Magea3 antikoerper

Hintergrund: MAGEA3 is a member of the MAGEA family. The members of this family have 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita.

Molekulargewicht: 35 kDa (MW of target protein)