PYCR2 Antikörper (C-Term)

Produktnummer ABIN631887

Dieser Anti-PYCR2-Antikörper ist ein Kaninchen-Polyklonal-Antikörper zum Nachweis von PYCR2 in WB. Geeignet für Human, Maus und Ratte.

Kurzübersicht für PYCR2 Antikörper (C-Term) (ABIN631887)

Target: PYCR2 (Pyrroline-5-Carboxylate Reductase Family, Member 2 (PYCR2))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PYCR2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PYCR2 Antikörper

Bindungsspezifität: C-Term

Spezifität: PYCR2 antibody was raised against the C terminal of PYCR2

Aufreinigung: Affinity purified

Immunogen: PYCR2 antibody was raised using the C terminal of PYCR2 corresponding to a region with amino acids LINAVEASCIRTRELQSMADQEKISPAALKKTLLDRVKLESPTVSTLTPS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PYCR2 Blocking Peptide, (ABIN940441), is also available for use as a blocking control in assays to test for specificity of this PYCR2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PYCR2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PYCR2

Target: PYCR2 (Pyrroline-5-Carboxylate Reductase Family, Member 2 (PYCR2))

Andere Bezeichnung: PYCR2

Hintergrund: PYCR2 belongs to the pyrroline-5-carboxylate reductase family. The function of the PYCR2 protein is not known.

Molekulargewicht: 34 kDa (MW of target protein)