RAD23B Antikörper

Produktnummer ABIN631882

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch RAD23B in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für RAD23B Antikörper (ABIN631882)

Target: RAD23B (RAD23 Homolog B (RAD23B))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RAD23B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-RAD23B Antikörper

Aufreinigung: Affinity purified

Immunogen: RAD23 B antibody was raised using a synthetic peptide corresponding to a region with amino acids QMRQIIQQNPSLLPALLQQIGRENPQLLQQISQHQEHFIQMLNEPVQEAG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RAD23B Blocking Peptide, (ABIN5615732), is also available for use as a blocking control in assays to test for specificity of this RAD23B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAD20 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RAD23B

Target: RAD23B (RAD23 Homolog B (RAD23B))

Andere Bezeichnung: RAD23B

Hintergrund: The protein encoded by this gene is one of two human homologs of Saccharomyces cerevisiae Rad23, a protein involved in the nucleotide excision repair (NER).

Molekulargewicht: 43 kDa (MW of target protein)

Pathways: DNA Reparatur