UBQLN4 Antikörper (Middle Region)

Produktnummer ABIN631881

Der Kaninchen Polyklonal anti-UBQLN4 Antikörper (ABIN631881) detektiert spezifisch UBQLN4 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für UBQLN4 Antikörper (Middle Region) (ABIN631881)

Target: UBQLN4 (Ubiquilin 4 (UBQLN4))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser UBQLN4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-UBQLN4 Antikörper

Bindungsspezifität: Middle Region

Spezifität: Ubiquilin 4 antibody was raised against the middle region of UBQLN4

Aufreinigung: Affinity purified

Immunogen: Ubiquilin 4 antibody was raised using the middle region of UBQLN4 corresponding to a region with amino acids TDIQEPMFSAAREQFGNNPFSSLAGNSDSSSSQPLRTENREPLPNPWSPS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Ubiquilin 4 Blocking Peptide, (ABIN5616884), is also available for use as a blocking control in assays to test for specificity of this Ubiquilin 4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBQLN4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu UBQLN4

Target: UBQLN4 (Ubiquilin 4 (UBQLN4))

Andere Bezeichnung: Ubiquilin 4

Hintergrund: The function of Ubiquilin 4 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 64 kDa (MW of target protein)