UBQLN4 Antikörper (Middle Region)
-
- Target Alle UBQLN4 Antikörper anzeigen
- UBQLN4 (Ubiquilin 4 (UBQLN4))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser UBQLN4 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Ubiquilin 4 antibody was raised against the middle region of UBQLN4
- Aufreinigung
- Affinity purified
- Immunogen
- Ubiquilin 4 antibody was raised using the middle region of UBQLN4 corresponding to a region with amino acids TDIQEPMFSAAREQFGNNPFSSLAGNSDSSSSQPLRTENREPLPNPWSPS
- Top Product
- Discover our top product UBQLN4 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Ubiquilin 4 Blocking Peptide, catalog no. 33R-9011, is also available for use as a blocking control in assays to test for specificity of this Ubiquilin 4 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBQLN4 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- UBQLN4 (Ubiquilin 4 (UBQLN4))
- Andere Bezeichnung
- Ubiquilin 4 (UBQLN4 Produkte)
- Synonyme
- a1u antikoerper, cip75 antikoerper, ubin antikoerper, ubiquilin-4 antikoerper, A1U antikoerper, A1Up antikoerper, C1orf6 antikoerper, CIP75 antikoerper, UBIN antikoerper, A1u antikoerper, AI663987 antikoerper, RGD1308273 antikoerper, ubiquilin 4 L homeolog antikoerper, ubiquilin 4 antikoerper, ubqln4.L antikoerper, ubqln4 antikoerper, UBQLN4 antikoerper, Ubqln4 antikoerper
- Hintergrund
- The function of Ubiquilin 4 protein is not widely studied, and is yet to be elucidated fully.
- Molekulargewicht
- 64 kDa (MW of target protein)
-