DPPA4 Antikörper (N-Term)

Produktnummer ABIN631866

Der Kaninchen Polyklonal anti-DPPA4 Antikörper (ABIN631866) detektiert spezifisch DPPA4 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für DPPA4 Antikörper (N-Term) (ABIN631866)

Target: DPPA4 (Developmental Pluripotency Associated 4 (DPPA4))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DPPA4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-DPPA4 Antikörper

Bindungsspezifität: N-Term

Spezifität: DPPA4 antibody was raised against the N terminal of DPPA4

Aufreinigung: Affinity purified

Immunogen: DPPA4 antibody was raised using the N terminal of DPPA4 corresponding to a region with amino acids MLRGSASSTSMEKAKGKEWTSTEKSREEDQQASNQPNSIALPGTSAKRTK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DPPA4 Blocking Peptide, (ABIN5613251), is also available for use as a blocking control in assays to test for specificity of this DPPA4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DPPA4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DPPA4

Target: DPPA4 (Developmental Pluripotency Associated 4 (DPPA4))

Andere Bezeichnung: DPPA4

Hintergrund: DPPA4 may play a role in maintaining cell pluripotentiality.

Molekulargewicht: 33 kDa (MW of target protein)