Kallikrein 13 Antikörper (Middle Region)

Produktnummer ABIN631838

Der Kaninchen Polyklonal Anti-Kallikrein 13-Antikörper wurde für WB validiert. Er ist geeignet, Kallikrein 13 in Proben von Human zu detektieren.

Kurzübersicht für Kallikrein 13 Antikörper (Middle Region) (ABIN631838)

Target: Kallikrein 13 (KLK13) (Kallikrein-Related Peptidase 13 (KLK13))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Kallikrein 13 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Kallikrein 13 Antikörper

Bindungsspezifität: Middle Region

Spezifität: KLK13 antibody was raised against the middle region of KLK13

Aufreinigung: Affinity purified

Immunogen: KLK13 antibody was raised using the middle region of KLK13 corresponding to a region with amino acids VLTAAHCLKEGLKVYLGKHALGRVEAGEQVREVVHSIPHPEYRRSPTHLN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KLK13 Blocking Peptide, (ABIN5614390), is also available for use as a blocking control in assays to test for specificity of this KLK13 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLK13 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Kallikrein 13

Target: Kallikrein 13 (KLK13) (Kallikrein-Related Peptidase 13 (KLK13))

Andere Bezeichnung: KLK13

Hintergrund: Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. Expression of this gene is regulated by steroid hormones and may be useful as a marker for breast cancer. An additional transcript variant has been identified, but its full length sequence has not been determined.

Molekulargewicht: 29 kDa (MW of target protein)

Pathways: Komplementsystem