Kallikrein 13 Antikörper (Middle Region)
-
- Target Alle Kallikrein 13 (KLK13) Antikörper anzeigen
- Kallikrein 13 (KLK13) (Kallikrein-Related Peptidase 13 (KLK13))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Kallikrein 13 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- KLK13 antibody was raised against the middle region of KLK13
- Aufreinigung
- Affinity purified
- Immunogen
- KLK13 antibody was raised using the middle region of KLK13 corresponding to a region with amino acids VLTAAHCLKEGLKVYLGKHALGRVEAGEQVREVVHSIPHPEYRRSPTHLN
- Top Product
- Discover our top product KLK13 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
KLK13 Blocking Peptide, catalog no. 33R-9689, is also available for use as a blocking control in assays to test for specificity of this KLK13 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLK13 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Kallikrein 13 (KLK13) (Kallikrein-Related Peptidase 13 (KLK13))
- Andere Bezeichnung
- KLK13 (KLK13 Produkte)
- Hintergrund
- Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. Expression of this gene is regulated by steroid hormones and may be useful as a marker for breast cancer. An additional transcript variant has been identified, but its full length sequence has not been determined.
- Molekulargewicht
- 29 kDa (MW of target protein)
- Pathways
- Komplementsystem
-