CRBN Antikörper (N-Term)

Produktnummer ABIN631784

Produktdetails anti-CRBN Antikörper

Target: CRBN (Cereblon (CRBN))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CRBN Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CRBN antibody was raised against the N terminal of CRBN

Aufreinigung: Affinity purified

Immunogen: CRBN antibody was raised using the N terminal of CRBN corresponding to a region with amino acids DQDSKEAKKPNIINFDTSLPTSHTYLGADMEEFHGRTLHDDDSCQVIPVL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CRBN Blocking Peptide, catalog no. 33R-2125, is also available for use as a blocking control in assays to test for specificity of this CRBN antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CRBN antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CRBN

Target: CRBN (Cereblon (CRBN))

Andere Bezeichnung: CRBN (CRBN Produkte)

Hintergrund: This gene encodes a protein related to the Lon protease protein family. In rodents and other mammals this gene product is found in the cytoplasm localized with a calcium channel membrane protein, and is thought to play a role in brain development.

Molekulargewicht: 50 kDa (MW of target protein)