Crossover junction endonuclease EME1 (EME1) Antikörper
-
- Target Alle Crossover junction endonuclease EME1 (EME1) Antikörper anzeigen
- Crossover junction endonuclease EME1 (EME1)
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- EME1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MALKKSSPSLDSGDSDSEELPTFAFLKKEPSSTKRRQPEREEKIVVVDIS
- Top Product
- Discover our top product EME1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
EME1 Blocking Peptide, catalog no. 33R-5688, is also available for use as a blocking control in assays to test for specificity of this EME1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EME1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Crossover junction endonuclease EME1 (EME1)
- Andere Bezeichnung
- EME1 (EME1 Produkte)
- Hintergrund
- EME1 and MUS81 form an endonuclease complex that cleaves branched DNA structures, especially those arising during stalled DNA replication.
- Molekulargewicht
- 63 kDa (MW of target protein)
-