Crossover junction endonuclease EME1 (EME1) Antikörper

Produktnummer ABIN631761

Der Kaninchen Polyklonal anti-Crossover junction endonuclease EME1 Antikörper (ABIN631761) detektiert spezifisch Crossover junction endonuclease EME1 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human und Maus.

Kurzübersicht für Crossover junction endonuclease EME1 (EME1) Antikörper (ABIN631761)

Target: Crossover junction endonuclease EME1 (EME1)

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails

Aufreinigung: Affinity purified

Immunogen: EME1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MALKKSSPSLDSGDSDSEELPTFAFLKKEPSSTKRRQPEREEKIVVVDIS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

EME1 Blocking Peptide, (ABIN5613363), is also available for use as a blocking control in assays to test for specificity of this EME1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EME1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Antigendetails

Target: Crossover junction endonuclease EME1 (EME1)

Andere Bezeichnung: EME1

Hintergrund: EME1 and MUS81 form an endonuclease complex that cleaves branched DNA structures, especially those arising during stalled DNA replication.

Molekulargewicht: 63 kDa (MW of target protein)