Crossover junction endonuclease EME1 (EME1) Antikörper

Produktnummer ABIN631761

Dieses Anti--Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von in WB. Geeignet für Human und Maus.

Kurzübersicht für Crossover junction endonuclease EME1 (EME1) Antikörper (ABIN631761)

Target: Crossover junction endonuclease EME1 (EME1)

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails

Aufreinigung: Affinity purified

Immunogen: EME1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MALKKSSPSLDSGDSDSEELPTFAFLKKEPSSTKRRQPEREEKIVVVDIS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

EME1 Blocking Peptide, (ABIN5613363), is also available for use as a blocking control in assays to test for specificity of this EME1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EME1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Antigendetails

Target: Crossover junction endonuclease EME1 (EME1)

Andere Bezeichnung: EME1

Hintergrund: EME1 and MUS81 form an endonuclease complex that cleaves branched DNA structures, especially those arising during stalled DNA replication.

Molekulargewicht: 63 kDa (MW of target protein)