PSAT1 Antikörper (N-Term)

Produktnummer ABIN631758

Dieses Anti-PSAT1-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von PSAT1 in WB und IHC. Geeignet für Human, Maus, Ratte und Hund.

Kurzübersicht für PSAT1 Antikörper (N-Term) (ABIN631758)

Target: PSAT1 (phosphoserine Aminotransferase 1 (PSAT1))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PSAT1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-PSAT1 Antikörper

Bindungsspezifität: N-Term

Spezifität: PSAT1 antibody was raised against the N terminal of PSAT1

Aufreinigung: Affinity purified

Immunogen: PSAT1 antibody was raised using the N terminal of PSAT1 corresponding to a region with amino acids ADYVVTGAWSAKAAEEAKKFGTINIVHPKLGSYTKIPDPSTWNLNPDASY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PSAT1 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this PSAT1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSAT1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PSAT1

Target: PSAT1 (phosphoserine Aminotransferase 1 (PSAT1))

Andere Bezeichnung: PSAT1

Hintergrund: PSAT1 is likely a phosphoserine aminotransferase, based on similarity to proteins in mouse, rabbit, and Drosophila.

Molekulargewicht: 40 kDa (MW of target protein)

Pathways: Warburg Effekt