Crossover junction endonuclease EME1 (EME1) Antikörper
-
- Target Alle Crossover junction endonuclease EME1 (EME1) Antikörper anzeigen
- Crossover junction endonuclease EME1 (EME1)
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- EME1 antibody was raised using a synthetic peptide corresponding to a region with amino acids AYPSPQLLVQAYQQCFSDKERQNLLADIQVRRGEGVTSTSRRIGPELSRR
- Top Product
- Discover our top product EME1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
EME1 Blocking Peptide, catalog no. 33R-1632, is also available for use as a blocking control in assays to test for specificity of this EME1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EME1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Crossover junction endonuclease EME1 (EME1)
- Andere Bezeichnung
- EME1 (EME1 Produkte)
- Synonyme
- 6820428D13 antikoerper, essential meiotic structure-specific endonuclease 1 antikoerper, Eme1 antikoerper
- Hintergrund
- EME1 interacts with MUS81 to form a DNA structure-specific endonuclease with substrate preference for branched DNA structures with a 5'-end at the branch nick. Typical substrates include 3'-flap structures, replication forks and nicked Holliday junctions. EME1 may be required in mitosis for the processing of stalled or collapsed replication forks.EME1 and MUS81 form an endonuclease complex that cleaves branched DNA structures, especially those arising during stalled DNA replication.
- Molekulargewicht
- 63 kDa (MW of target protein)
-