SUMO3 Antikörper

Produktnummer ABIN631719

Der Kaninchen Polyklonal anti-SUMO3 Antikörper (ABIN631719) detektiert spezifisch SUMO3 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für SUMO3 Antikörper (ABIN631719)

Target: SUMO3 (Small Ubiquitin Related Modifier 3 (SUMO3))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SUMO3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SUMO3 Antikörper

Aufreinigung: Affinity purified

Immunogen: SUMO3 antibody was raised using a synthetic peptide corresponding to a region with amino acids MRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVPESSLAGHSF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SUMO3 Blocking Peptide, (ABIN5616458), is also available for use as a blocking control in assays to test for specificity of this SUMO3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SUMO3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SUMO3

Target: SUMO3 (Small Ubiquitin Related Modifier 3 (SUMO3))

Andere Bezeichnung: SUMO3

Hintergrund: SUMO proteins, such as SUMO3, and ubiquitin posttranslationally modify numerous cellular proteins and affect their metabolism and function. However, unlike ubiquitination, which targets proteins for degradation, sumoylation participates in a number of cellular processes, such as nuclear transport, transcriptional regulation, apoptosis, and protein stability.

Molekulargewicht: 12 kDa (MW of target protein)