NEDD1 Antikörper (N-Term)

Produktnummer ABIN631703

Produktdetails anti-NEDD1 Antikörper

Target: NEDD1 (Neural Precursor Cell Expressed, Developmentally Down-Regulated 1 (NEDD1))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NEDD1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: NEDD1 antibody was raised against the N terminal of NEDD1

Aufreinigung: Affinity purified

Immunogen: NEDD1 antibody was raised using the N terminal of NEDD1 corresponding to a region with amino acids MQENLRFASSGDDIKIWDASSMTLVDKFNPHTSPHGISSICWSSNNNFLV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NEDD1 Blocking Peptide, catalog no. 33R-6323, is also available for use as a blocking control in assays to test for specificity of this NEDD1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NEDD1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NEDD1

Target: NEDD1 (Neural Precursor Cell Expressed, Developmentally Down-Regulated 1 (NEDD1))

Andere Bezeichnung: NEDD1 (NEDD1 Produkte)

Synonyme: MGC81767 antikoerper, MGC145237 antikoerper, GCP-WD antikoerper, TUBGCP7 antikoerper, neural precursor cell expressed, developmentally down-regulated 1 L homeolog antikoerper, neural precursor cell expressed, developmentally down-regulated 1 antikoerper, cilia and flagella associated protein 54 antikoerper, neural precursor cell expressed, developmentally down-regulated gene 1 antikoerper, nedd1.L antikoerper, nedd1 antikoerper, CFAP54 antikoerper, NEDD1 antikoerper, Nedd1 antikoerper

Hintergrund: NEDD1 is required for mitosis progression. NEDD1 promotes the nucleation of microtubules from the spindle.

Molekulargewicht: 72 kDa (MW of target protein)

Pathways: M Phase