NEDD1 Antikörper (N-Term)

Produktnummer ABIN631703

Der Kaninchen Polyklonal Anti-NEDD1-Antikörper wurde für WB validiert. Er ist geeignet, NEDD1 in Proben von Human, Maus und Ratte zu detektieren.

Kurzübersicht für NEDD1 Antikörper (N-Term) (ABIN631703)

Target: NEDD1 (Neural Precursor Cell Expressed, Developmentally Down-Regulated 1 (NEDD1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NEDD1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-NEDD1 Antikörper

Bindungsspezifität: N-Term

Spezifität: NEDD1 antibody was raised against the N terminal of NEDD1

Aufreinigung: Affinity purified

Immunogen: NEDD1 antibody was raised using the N terminal of NEDD1 corresponding to a region with amino acids MQENLRFASSGDDIKIWDASSMTLVDKFNPHTSPHGISSICWSSNNNFLV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NEDD1 Blocking Peptide, (ABIN5614951), is also available for use as a blocking control in assays to test for specificity of this NEDD1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NEDD1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NEDD1

Target: NEDD1 (Neural Precursor Cell Expressed, Developmentally Down-Regulated 1 (NEDD1))

Andere Bezeichnung: NEDD1

Hintergrund: NEDD1 is required for mitosis progression. NEDD1 promotes the nucleation of microtubules from the spindle.

Molekulargewicht: 72 kDa (MW of target protein)

Pathways: M Phase