APRT Antikörper (N-Term)

Produktnummer ABIN631682

Produktdetails anti-APRT Antikörper

Target: APRT (Adenine Phosphoribosyltransferase (APRT))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser APRT Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: APRT antibody was raised against the N terminal of APRT

Aufreinigung: Affinity purified

Immunogen: APRT antibody was raised using the N terminal of APRT corresponding to a region with amino acids ADSELQLVEQRIRSFPDFPTPGVVFRDISPVLKDPASFRAAIGLLARHLK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

APRT Blocking Peptide, catalog no. 33R-1105, is also available for use as a blocking control in assays to test for specificity of this APRT antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of APRT antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu APRT

Target: APRT (Adenine Phosphoribosyltransferase (APRT))

Andere Bezeichnung: APRT (APRT Produkte)

Synonyme: Tb07.43M14.200 antikoerper, Tb07.43M14.180 antikoerper, C85684 antikoerper, AMP antikoerper, APRTD antikoerper, adenine phosphoribosyltransferase antikoerper, adenine phosphoribosyl transferase antikoerper, CND05020 antikoerper, Tb927.7.1790 antikoerper, Tb927.7.1780 antikoerper, Arnit_0941 antikoerper, Saut_1231 antikoerper, Fbal_1180 antikoerper, PH_RS07970 antikoerper, PF_RS08760 antikoerper, PAB_RS02560 antikoerper, Aprt antikoerper, APRT antikoerper

Hintergrund: Adenine phosphoribosyltransferase (APRT) belongs to the purine/pyrimidine phosphoribosyltransferase family. A conserved feature of this gene is the distribution of CpG dinucleotides. This enzyme catalyzes the formation of AMP and inorganic pyrophosphate from adenine and 5-phosphoribosyl-1-pyrophosphate (PRPP). It also produces adenine as a by-product of the polyamine biosynthesis pathway. A homozygous deficiency in this enzyme causes 2,8-dihydroxyadenine urolithiasis.

Molekulargewicht: 20 kDa (MW of target protein)

Pathways: Ribonucleoside Biosynthetic Process