APRT Antikörper (N-Term)
-
- Target Alle APRT Antikörper anzeigen
- APRT (Adenine Phosphoribosyltransferase (APRT))
-
Bindungsspezifität
- AA 5-49, N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser APRT Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Verwendungszweck
- Rabbit IgG polyclonal antibody for Adenine phosphoribosyltransferase(APRT) detection. Tested with WB in Human.
- Sequenz
- ELQLVEQRIR SFPDFPTPGV VFRDISPVLK DPASFRAAIG LLARH
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
-
Rabbit IgG polyclonal antibody for Adenine phosphoribosyltransferase(APRT) detection. Tested with WB in Human.
Gene Name: adenine phosphoribosyltransferase
Protein Name: Adenine phosphoribosyltransferase - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-terminus of human APRT (5-49aa ELQLVEQRIRSFPDFPTPGVVFRDISPVLKDPASFRAAIGLLARH), different from the related mouse sequence by ten amino acids, and from the related rat sequence by nine amino acids.
- Isotyp
- IgG
- Top Product
- Discover our top product APRT Primärantikörper
-
-
- Applikationshinweise
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Kommentare
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handhabung
- Avoid repeated freezing and thawing.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- APRT (Adenine Phosphoribosyltransferase (APRT))
- Andere Bezeichnung
- APRT (APRT Produkte)
- Synonyme
- Tb07.43M14.200 antikoerper, Tb07.43M14.180 antikoerper, C85684 antikoerper, AMP antikoerper, APRTD antikoerper, adenine phosphoribosyltransferase antikoerper, adenine phosphoribosyl transferase antikoerper, CND05020 antikoerper, Tb927.7.1790 antikoerper, Tb927.7.1780 antikoerper, Arnit_0941 antikoerper, Saut_1231 antikoerper, Fbal_1180 antikoerper, PH_RS07970 antikoerper, PF_RS08760 antikoerper, PAB_RS02560 antikoerper, Aprt antikoerper, APRT antikoerper
- Hintergrund
-
Adenine phosphoribosyltransferase (APRTase) is an enzyme encoded by the APRT gene, found in humans on chromosome 16. It belongs to the purine/pyrimidine phosphoribosyltransferase family. A conserved feature of this gene is the distribution of CpG dinucleotides. This enzyme catalyzes the formation of AMP and inorganic pyrophosphate from adenine and 5-phosphoribosyl-1-pyrophosphate (PRPP). It also produces adenine as a by-product of the polyamine biosynthesis pathway. A homozygous deficiency in this enzyme causes 2,8-dihydroxyadenine urolithiasis. Two transcript variants encoding different isoforms have been found for this gene.
Synonyms: AMP | AMP diphosphorylase | AMP pyrophosphorylase | APRT | APRTD | Transphosphoribosidase | P07741 - Gen-ID
- 353
- UniProt
- P07741
- Pathways
- Ribonucleoside Biosynthetic Process
-