UBE2E1 Antikörper

Produktnummer ABIN631662

Dieses Anti-UBE2E1-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von UBE2E1 in WB. Geeignet für Human, Maus und Drosophila melanogaster.

Kurzübersicht für UBE2E1 Antikörper (ABIN631662)

Target: UBE2E1 (Ubiquitin-Conjugating Enzyme E2E 1 (UBE2E1))

Reaktivität: Human, Maus, Drosophila melanogaster

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser UBE2E1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-UBE2E1 Antikörper

Aufreinigung: Affinity purified

Immunogen: UBE2 E1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PKGDNIYEWRSTILGPPGSVYEGGVFFLDITFTPEYPFKPPKVTFRTRIY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

UBE2E1 Blocking Peptide, (ABIN5616864), is also available for use as a blocking control in assays to test for specificity of this UBE2E1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBE0 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu UBE2E1

Target: UBE2E1 (Ubiquitin-Conjugating Enzyme E2E 1 (UBE2E1))

Andere Bezeichnung: UBE2E1

Hintergrund: UBE2E1 catalyzes the covalent attachment of ubiquitin to other proteins. UBE2E1 mediates the selective degradation of short-lived and abnormal proteins.

Molekulargewicht: 21 kDa (MW of target protein)

Pathways: Ubiquitin Proteasome Pathway