UBE2D3 Antikörper

Produktnummer ABIN631661

Produktdetails anti-UBE2D3 Antikörper

Target: UBE2D3 (Ubiquitin-Conjugating Enzyme E2D 3 (UBE2D3))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser UBE2D3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: UBE2 D3 antibody was raised using a synthetic peptide corresponding to a region with amino acids MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

UBE2D3 Blocking Peptide, catalog no. 33R-5691, is also available for use as a blocking control in assays to test for specificity of this UBE2D3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBE0 3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu UBE2D3

Target: UBE2D3 (Ubiquitin-Conjugating Enzyme E2D 3 (UBE2D3))

Andere Bezeichnung: UBE2D3 (UBE2D3 Produkte)

Synonyme: E2(17)KB3 antikoerper, UBC4/5 antikoerper, UBCH5C antikoerper, eff antikoerper, fb36f02 antikoerper, wu:fb36f02 antikoerper, zgc:56340 antikoerper, 1100001F19Rik antikoerper, 9430029A22Rik antikoerper, AA414951 antikoerper, UBE2D3P antikoerper, Xubc4 antikoerper, e2(17)kb3 antikoerper, ubc4/5 antikoerper, ubch5c antikoerper, ube2d3.1 antikoerper, ube2d2 antikoerper, xubc4 antikoerper, wu:fj13d01 antikoerper, zgc:73200 antikoerper, ubiquitin conjugating enzyme E2 D3 antikoerper, ubiquitin-conjugating enzyme E2D 3 antikoerper, ubiquitin conjugating enzyme E2 D3 L homeolog antikoerper, ubiquitin-conjugating enzyme E2D 2 (UBC4/5 homolog, yeast), like antikoerper, UBE2D3 antikoerper, ube2d3 antikoerper, Ube2d3 antikoerper, LOC100223566 antikoerper, ube2d3.L antikoerper, ube2d2l antikoerper

Hintergrund: The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. UBE2D3 is a member of the E2 ubiquitin-conjugating enzyme family. This enzyme functions in the ubiquitination of the tumor-suppressor protein p53, which is induced by an E3 ubiquitin-protein ligase.

Molekulargewicht: 17 kDa (MW of target protein)

Pathways: Activation of Innate immune Response, Toll-Like Receptors Cascades