COG4 Antikörper (Middle Region)

Produktnummer ABIN631569

Dieses Anti-COG4-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von COG4 in WB. Geeignet für Human, Maus und Ratte.

Kurzübersicht für COG4 Antikörper (Middle Region) (ABIN631569)

Target: COG4 (Component of Oligomeric Golgi Complex 4 (COG4))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser COG4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-COG4 Antikörper

Bindungsspezifität: Middle Region

Spezifität: COG4 antibody was raised against the middle region of COG4

Aufreinigung: Affinity purified

Immunogen: COG4 antibody was raised using the middle region of COG4 corresponding to a region with amino acids LFSQGIGGEQAQAKFDSCLSDLAAVSNKFRDLLQEGLTELNSTAIKPQVQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

COG4 Blocking Peptide, catalog no. 33R-4949, is also available for use as a blocking control in assays to test for specificity of this COG4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of COG4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu COG4

Target: COG4 (Component of Oligomeric Golgi Complex 4 (COG4))

Andere Bezeichnung: COG4

Hintergrund: Multiprotein complexes are key determinants of Golgi apparatus structure and its capacity for intracellular transport and glycoprotein modification. Several complexes have been identified, including the Golgi transport complex (GTC), the LDLC complex, which is involved in glycosylation reactions, and the SEC34 complex, which is involved in vesicular transport. These 3 complexes are identical and have been termed the conserved oligomeric Golgi (COG) complex, which includes COG4.

Molekulargewicht: 89 kDa (MW of target protein)