GCLC Antikörper (N-Term)

Produktnummer ABIN631566

Produktdetails anti-GCLC Antikörper

Target: GCLC (Glutamate-Cysteine Ligase, Catalytic Subunit (GCLC))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GCLC Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: GCLC antibody was raised against the N terminal of GCLC

Aufreinigung: Affinity purified

Immunogen: GCLC antibody was raised using the N terminal of GCLC corresponding to a region with amino acids VLETLQEKGERTNPNHPTLWRPEYGSYMIEGTPGQPYGGTMSEFNTVEAN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GCLC Blocking Peptide, catalog no. 33R-9653, is also available for use as a blocking control in assays to test for specificity of this GCLC antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GCLC antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GCLC

Target: GCLC (Glutamate-Cysteine Ligase, Catalytic Subunit (GCLC))

Andere Bezeichnung: GCLC (GCLC Produkte)

Synonyme: GCLC antikoerper, gclc antikoerper, MGC146287 antikoerper, 2259 antikoerper, CG2259 antikoerper, DmGCLC antikoerper, DmGCS antikoerper, DmGCSh antikoerper, Dmel\\CG2259 antikoerper, GCL antikoerper, GCLc antikoerper, GCSh antikoerper, Gcs antikoerper, Gcsh antikoerper, DDBDRAFT_0186120 antikoerper, DDBDRAFT_0231403 antikoerper, DDB_0186120 antikoerper, DDB_0231403 antikoerper, GCS antikoerper, GLCL antikoerper, GLCLC antikoerper, D9Wsu168e antikoerper, GLCL-H antikoerper, Ggcs-hs antikoerper, Glclc antikoerper, cb1049 antikoerper, fe36e11 antikoerper, wu:fe36e11 antikoerper, glutamate-cysteine ligase catalytic subunit antikoerper, glutamate-cysteine ligase, catalytic subunit antikoerper, Glutamate-cysteine ligase catalytic subunit antikoerper, gamma glutamylcysteine synthetase antikoerper, glutamate-cysteine ligase, catalytic subunit L homeolog antikoerper, glutamate-cysteine ligase, catalytic subunit S homeolog antikoerper, gamma-glutamylcysteine synthetase antikoerper, GCLC antikoerper, gclc antikoerper, Gclc antikoerper, LbGCS antikoerper, gcsA antikoerper, gclc.L antikoerper, gclc.S antikoerper, GSH1 antikoerper

Hintergrund: Glutamate-cysteine ligase, also known as gamma-glutamylcysteine synthetase is the first rate limiting enzyme of glutathione synthesis. The enzyme consists of two subunits, a heavy catalytic subunit and a light regulatory subunit. GCLC is the catalytic subunit of 637 amino acids with a calculated molecular weight of 72.773 kDa. Deficiency of gamma-glutamylcysteine synthetase in human is associated with enzymopathic hemolytic anemia.

Molekulargewicht: 73 kDa (MW of target protein)

Pathways: Cell RedoxHomeostasis