Glutamate-Cysteine Ligase, Catalytic Subunit (GCLC) (AA 528-637) Antikörper

Details zu Produkt Nr. ABIN561050
Antigen
  • GCLC
  • gclc
  • MGC146287
  • 2259
  • CG2259
  • DmGCLC
  • DmGCS
  • DmGCSh
  • Dmel\\CG2259
  • GCL
  • GCLc
  • GCSh
  • Gcs
  • Gcsh
  • DDBDRAFT_0186120
  • DDBDRAFT_0231403
  • DDB_0186120
  • DDB_0231403
  • GCS
  • GLCL
  • GLCLC
  • D9Wsu168e
  • GLCL-H
  • Ggcs-hs
  • Glclc
  • cb1049
  • fe36e11
  • wu:fe36e11
  • glutamate-cysteine ligase catalytic subunit
  • glutamate-cysteine ligase, catalytic subunit
  • Glutamate-cysteine ligase catalytic subunit
  • gamma glutamylcysteine synthetase
  • glutamate-cysteine ligase, catalytic subunit L homeolog
  • glutamate-cysteine ligase, catalytic subunit S homeolog
  • gamma-glutamylcysteine synthetase
  • GCLC
  • gclc
  • Gclc
  • LbGCS
  • gcsA
  • gclc.L
  • gclc.S
  • GSH1
Epitop
AA 528-637
14
11
9
9
9
9
8
7
6
3
3
3
2
2
2
1
1
1
Reaktivität
Human
111
61
53
11
10
6
4
3
3
2
1
1
1
1
1
1
1
1
Wirt
Maus
118
7
Klonalität (Klon)
Monoklonal ()
Konjugat
Unkonjugiert
7
5
5
4
4
4
3
3
3
3
3
3
1
1
1
1
1
Applikation
Immunofluorescence (IF), ELISA, Western Blotting (WB)
97
47
39
24
18
18
15
13
11
4
2
2
1
Optionen
Verwendungszweck Mouse monoclonal antibody raised against a partial recombinant GCLC.
Immunogen

immunogen: GCLC (NP_001489, 528 a.a. ~ 637 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Immunogen Sequence: EGVFPGLIPILNSYLENMEVDVDTRCSILNYLKLIKKRASGELMTVARWMREFIANHPDYKQDSVITDEMNYSLILKCNQIANELCECPELLGSAFRKVKYSGSKTDSSN

Klon 3H1
Isotyp IgG1 kappa
Kreuzreaktivität Human, Maus, Ratte (Rattus)
Antigen
Andere Bezeichnung GCLC (GCLC Antibody Abstract)
Hintergrund Full Gene Name: glutamate-cysteine ligase, catalytic subunit
Synonyms: GCS,GLCL,GLCLC
Gen-ID 2729
NCBI Accession NP_001489, NM_001498
Pathways Cell RedoxHomeostasis
Applikations-hinweise Optimal working dilution should be determined by the investigator.
Kommentare

Product Quality tested by: Antibody Reactive Against Recombinant Protein.

Beschränkungen Nur für Forschungszwecke einsetzbar
Buffer In 1x PBS, pH 7.4
Handhabung Aliquot to avoid repeated freezing and thawing.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Bilder des Herstellers
Image no. 1 for anti-Glutamate-Cysteine Ligase, Catalytic Subunit (GCLC) (AA 528-637) antibody (ABIN561050) Immunofluorescence of monoclonal antibody to GCLC on HeLa cell. [antibody concentrati...
Image no. 2 for anti-Glutamate-Cysteine Ligase, Catalytic Subunit (GCLC) (AA 528-637) antibody (ABIN561050) GCLC monoclonal antibody (M01), clone 3H1 Western Blot analysis of GCLC expression in...
Image no. 3 for anti-Glutamate-Cysteine Ligase, Catalytic Subunit (GCLC) (AA 528-637) antibody (ABIN561050) Detection limit for recombinant GST tagged GCLC is approximately 0.03ng/ml as a captu...
Image no. 4 for anti-Glutamate-Cysteine Ligase, Catalytic Subunit (GCLC) (AA 528-637) antibody (ABIN561050) Western Blot analysis of GCLC expression in transfected 293T cell line by GCLC monocl...
Image no. 5 for anti-Glutamate-Cysteine Ligase, Catalytic Subunit (GCLC) (AA 528-637) antibody (ABIN561050) Western Blot detection against Immunogen (37.84 KDa) .
Image no. 6 for anti-Glutamate-Cysteine Ligase, Catalytic Subunit (GCLC) (AA 528-637) antibody (ABIN561050) GCLC monoclonal antibody (M01), clone 3H1. Western Blot analysis of GCLC expression i...
Image no. 7 for anti-Glutamate-Cysteine Ligase, Catalytic Subunit (GCLC) (AA 528-637) antibody (ABIN561050) GCLC monoclonal antibody (M01), clone 3H1. Western Blot analysis of GCLC expression i...
Produkt verwendet in: Sugiyama, Ebinuma, Nakamoto, Sakasegawa, Murakami, Chu, Usui, Ishibashi, Wakayama, Taniki, Murata, Saito, Fukasawa, Saito, Yamagishi, Wakita, Takaku, Hibi, Saito, Kanai: "Prominent steatosis with hypermetabolism of the cell line permissive for years of infection with hepatitis C virus." in: PLoS ONE, Vol. 9, Issue 4, pp. e94460, 2014 (PubMed).

Venè, Cardinali, Arena, Ferrari, Benelli, Minghelli, Poggi, Noonan, Albini, Tosetti: "Glycogen synthase kinase 3 regulates cell death and survival signaling in tumor cells under redox stress." in: Neoplasia (New York, N.Y.), Vol. 16, Issue 9, pp. 710-22, 2014 (PubMed).

Li, Gunter, Fukagawa: "Differential activation of the inflammasome in THP-1 cells exposed to chrysotile asbestos and Libby "six-mix" amphiboles and subsequent activation of BEAS-2B cells." in: Cytokine, Vol. 60, Issue 3, pp. 718-30, 2012 (PubMed).

Fan, Liu, Hao, Wang, Robinson, Monnier: "The LEGSKO mouse: a mouse model of age-related nuclear cataract based on genetic suppression of lens glutathione synthesis." in: PLoS ONE, Vol. 7, Issue 11, pp. e50832, 2012 (PubMed).

Abel, Bubel, Simper, Powell, McClellan, Andreeff, MacLeod, DiGiovanni: "Protection against 2-chloroethyl ethyl sulfide (CEES)-induced cytotoxicity in human keratinocytes by an inducer of the glutathione detoxification pathway." in: Toxicology and applied pharmacology, Vol. 255, Issue 2, pp. 176-83, 2011 (PubMed).

Hardwick, Fisher, Canet, Lake, Cherrington: "Diversity in antioxidant response enzymes in progressive stages of human nonalcoholic fatty liver disease." in: Drug metabolism and disposition: the biological fate of chemicals, Vol. 38, Issue 12, pp. 2293-301, 2010 (PubMed).

Haben Sie etwas anderes gesucht?