GCLC Antikörper (N-Term)

Produktnummer ABIN631566

Dieses Anti-GCLC-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von GCLC in WB. Geeignet für Human, Maus und Ratte.

Kurzübersicht für GCLC Antikörper (N-Term) (ABIN631566)

Target: GCLC (Glutamate-Cysteine Ligase, Catalytic Subunit (GCLC))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GCLC Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-GCLC Antikörper

Bindungsspezifität: N-Term

Spezifität: GCLC antibody was raised against the N terminal of GCLC

Aufreinigung: Affinity purified

Immunogen: GCLC antibody was raised using the N terminal of GCLC corresponding to a region with amino acids VLETLQEKGERTNPNHPTLWRPEYGSYMIEGTPGQPYGGTMSEFNTVEAN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GCLC Blocking Peptide, (ABIN5613739), is also available for use as a blocking control in assays to test for specificity of this GCLC antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GCLC antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GCLC

Target: GCLC (Glutamate-Cysteine Ligase, Catalytic Subunit (GCLC))

Andere Bezeichnung: GCLC

Hintergrund: Glutamate-cysteine ligase, also known as gamma-glutamylcysteine synthetase is the first rate limiting enzyme of glutathione synthesis. The enzyme consists of two subunits, a heavy catalytic subunit and a light regulatory subunit. GCLC is the catalytic subunit of 637 amino acids with a calculated molecular weight of 72.773 kDa. Deficiency of gamma-glutamylcysteine synthetase in human is associated with enzymopathic hemolytic anemia.

Molekulargewicht: 73 kDa (MW of target protein)

Pathways: Cell RedoxHomeostasis