RABGGTA Antikörper (N-Term)

Produktnummer ABIN631549

Produktdetails anti-RABGGTA Antikörper

Target: RABGGTA (Rab Geranylgeranyltransferase, alpha Subunit (RABGGTA))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RABGGTA Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RABGGTA antibody was raised against the N terminal of RABGGTA

Aufreinigung: Affinity purified

Immunogen: RABGGTA antibody was raised using the N terminal of RABGGTA corresponding to a region with amino acids ELAFTDSLITRNFSNYSSWHYRSCLLPQLHPQPDSGPQGRLPEDVLLKEL

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RABGGTA Blocking Peptide, catalog no. 33R-2527, is also available for use as a blocking control in assays to test for specificity of this RABGGTA antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RABGGTA antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RABGGTA

Target: RABGGTA (Rab Geranylgeranyltransferase, alpha Subunit (RABGGTA))

Andere Bezeichnung: RABGGTA (RABGGTA Produkte)

Synonyme: gm antikoerper, PTAR3 antikoerper, Rab geranylgeranyl transferase, a subunit antikoerper, Rab geranylgeranyltransferase alpha subunit antikoerper, Rab geranylgeranyltransferase, alpha subunit antikoerper, Rabggta antikoerper, RABGGTA antikoerper

Hintergrund: RABGGTA belongs to the protein prenyltransferase subunit alpha family and contains 6 PFTA repeats. RABGGTA catalyzes the transfer of a geranyl-geranyl moiety from geranyl-geranyl pyrophosphate to both cysteines in Rab proteins with an -XXCC, -XCXC and -CCXX C-terminal, such as RAB1A, RAB3A and RAB5A respectively.

Molekulargewicht: 65 kDa (MW of target protein)