CHST14 Antikörper
-
- Target Alle CHST14 Antikörper anzeigen
- CHST14 (Carbohydrate (N-Acetylgalactosamine 4-0) Sulfotransferase 14 (CHST14))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CHST14 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- CHST14 antibody was raised using a synthetic peptide corresponding to a region with amino acids REYQQRYGAEIVRRYRAGAGPSPAGDDVTFPEFLRYLVDEDPERMNEHWM
- Top Product
- Discover our top product CHST14 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CHST14 Blocking Peptide, catalog no. 33R-7896, is also available for use as a blocking control in assays to test for specificity of this CHST14 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHST14 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CHST14 (Carbohydrate (N-Acetylgalactosamine 4-0) Sulfotransferase 14 (CHST14))
- Andere Bezeichnung
- CHST14 (CHST14 Produkte)
- Synonyme
- ATCS antikoerper, D4ST1 antikoerper, HNK1ST antikoerper, 2600016L03Rik antikoerper, D4ST-1 antikoerper, D4st1 antikoerper, d4st1 antikoerper, MGC136487 antikoerper, wu:fc04a01 antikoerper, zgc:136487 antikoerper, carbohydrate sulfotransferase 14 antikoerper, carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 14 antikoerper, CHST14 antikoerper, Chst14 antikoerper, chst14 antikoerper
- Hintergrund
- CHST14 belongs to the sulfotransferase 2 family. CHST14 catalyzes the transfer of sulfate to position 4 of the N-acetylgalactosamine (GalNAc) residue of dermatan sulfate. It transfers sulfate to the C-4 hydroxyl of beta1,4-linked GalNAc that is substituted with an alpha-linked iduronic acid (IdoUA) at the C-3 hydroxyl. It transfers sulfate more efficiently to GalNAc residues in -IdoUA-GalNAc-IdoUA- than in -GlcUA-GalNAc-GlcUA-sequences. CHST14 has preference for partially desulfated dermatan sulfate. Addition of sulfate to GalNAc may occur immediately after epimerization of GlcUA to IdoUA.
- Molekulargewicht
- 35 kDa (MW of target protein)
- Pathways
- Glycosaminoglycan Metabolic Process
-