CHST14 Antikörper

Produktnummer ABIN631540

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch CHST14 in WB. Es zeigt Reaktivität gegenüber Proben von Human, Maus und Ratte.

Kurzübersicht für CHST14 Antikörper (ABIN631540)

Target: CHST14 (Carbohydrate (N-Acetylgalactosamine 4-0) Sulfotransferase 14 (CHST14))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CHST14 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-CHST14 Antikörper

Aufreinigung: Affinity purified

Immunogen: CHST14 antibody was raised using a synthetic peptide corresponding to a region with amino acids REYQQRYGAEIVRRYRAGAGPSPAGDDVTFPEFLRYLVDEDPERMNEHWM

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CHST14 Blocking Peptide, (ABIN5612876), is also available for use as a blocking control in assays to test for specificity of this CHST14 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHST14 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CHST14

Target: CHST14 (Carbohydrate (N-Acetylgalactosamine 4-0) Sulfotransferase 14 (CHST14))

Andere Bezeichnung: CHST14

Hintergrund: CHST14 belongs to the sulfotransferase 2 family. CHST14 catalyzes the transfer of sulfate to position 4 of the N-acetylgalactosamine (GalNAc) residue of dermatan sulfate. It transfers sulfate to the C-4 hydroxyl of beta1,4-linked GalNAc that is substituted with an alpha-linked iduronic acid (IdoUA) at the C-3 hydroxyl. It transfers sulfate more efficiently to GalNAc residues in -IdoUA-GalNAc-IdoUA- than in -GlcUA-GalNAc-GlcUA-sequences. CHST14 has preference for partially desulfated dermatan sulfate. Addition of sulfate to GalNAc may occur immediately after epimerization of GlcUA to IdoUA.

Molekulargewicht: 35 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process