AADAT Antikörper (Middle Region)

Produktnummer ABIN631490

Der Kaninchen Polyklonal anti-AADAT Antikörper wird verwendet zum Nachweis von AADAT in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für AADAT Antikörper (Middle Region) (ABIN631490)

Target: AADAT (Aminoadipate Aminotransferase (AADAT))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser AADAT Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-AADAT Antikörper

Bindungsspezifität: Middle Region

Spezifität: AADAT antibody was raised against the middle region of AADAT

Aufreinigung: Affinity purified

Immunogen: AADAT antibody was raised using the middle region of AADAT corresponding to a region with amino acids EIYELARKYDFLIIEDDPYYFLQFNKFRVPTFLSMDVDGRVIRADSFSKI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

AADAT Blocking Peptide, (ABIN937877), is also available for use as a blocking control in assays to test for specificity of this AADAT antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AADAT antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu AADAT

Target: AADAT (Aminoadipate Aminotransferase (AADAT))

Andere Bezeichnung: AADAT

Hintergrund: AADAT is a protein that is highly similar to mouse and rat kynurenine aminotransferase II. The rat protein is a homodimer with two transaminase activities.

Molekulargewicht: 47 kDa (MW of target protein)