AADAT Antikörper (N-Term)

Produktnummer ABIN629693

Produktdetails anti-AADAT Antikörper

Target: AADAT (Aminoadipate Aminotransferase (AADAT))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser AADAT Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: AADAT antibody was raised against the N terminal of AADAT

Aufreinigung: Purified

Immunogen: AADAT antibody was raised using the N terminal of AADAT corresponding to a region with amino acids AVITVENGKTIQFGEEMMKRALQYSPSAGIPELLSWLKQLQIKLHNPPTI

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

AADAT Blocking Peptide, catalog no. 33R-1601, is also available for use as a blocking control in assays to test for specificity of this AADAT antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AADAT antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu AADAT

Target: AADAT (Aminoadipate Aminotransferase (AADAT))

Andere Bezeichnung: AADAT (AADAT Produkte)

Synonyme: KAT2 antikoerper, KATII antikoerper, AI875679 antikoerper, Aadt antikoerper, Kat2 antikoerper, mKat-2 antikoerper, MGC80030 antikoerper, kat2 antikoerper, katii antikoerper, aminoadipate aminotransferase antikoerper, aminoadipate aminotransferase S homeolog antikoerper, AADAT antikoerper, Aadat antikoerper, aadat.S antikoerper, aadat antikoerper

Hintergrund: AADAT is a protein that is highly similar to mouse and rat kynurenine aminotransferase II. The rat protein is a homodimer with two transaminase activities. One activity is the transamination of alpha-aminoadipic acid, a final step in the saccaropine pathway which is the major pathway for L-lysine catabolism. The other activity involves the transamination of kynurenine to produce kynurenine acid, the precursor of kynurenic acid which has neuroprotective properties.

Molekulargewicht: 47 kDa (MW of target protein)