TUBA4A Antikörper (Middle Region)
-
- Target Alle TUBA4A Antikörper anzeigen
- TUBA4A (Tubulin, alpha 4a (TUBA4A))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte, Drosophila melanogaster, Arabidopsis, C. elegans
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TUBA4A Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Alpha Tubulin 4 A antibody was raised against the middle region of TUBA4
- Aufreinigung
- Affinity purified
- Immunogen
- alpha Tubulin 4 A antibody was raised using the middle region of TUBA4 corresponding to a region with amino acids GGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTH
- Top Product
- Discover our top product TUBA4A Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
alpha Tubulin 4A Blocking Peptide, catalog no. 33R-3301, is also available for use as a blocking control in assays to test for specificity of this alpha Tubulin 4A antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TUBA0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TUBA4A (Tubulin, alpha 4a (TUBA4A))
- Andere Bezeichnung
- alpha Tubulin 4A (TUBA4A Produkte)
- Synonyme
- TUBA1 antikoerper, TUBA6 antikoerper, H2-ALPHA antikoerper, M[a]4 antikoerper, Tuba4 antikoerper, tuba1 antikoerper, tubulin alpha 1a antikoerper, tubulin alpha 4a antikoerper, tubulin, alpha 4A antikoerper, tubulin alpha 4a L homeolog antikoerper, TUBA1A antikoerper, TUBA4A antikoerper, Tuba4a antikoerper, tuba4a.L antikoerper
- Hintergrund
- Microtubules of the eukaryotic cytoskeleton perform essential and diverse functions and are composed of a heterodimer of alpha and beta tubulin. The genes encoding these microtubule constituents are part of the tubulin superfamily.
- Molekulargewicht
- 50 kDa (MW of target protein)
- Pathways
- Microtubule Dynamics, M Phase
-