TUBA4A Antikörper (Middle Region)

Produktnummer ABIN631484

Der Kaninchen Polyklonal anti-TUBA4A Antikörper wird verwendet zum Nachweis von TUBA4A in Proben von Human, Maus, Ratte, Drosophila melanogaster, Arabidopsis und C. elegans. Er wurde validiert für WB.

Kurzübersicht für TUBA4A Antikörper (Middle Region) (ABIN631484)

Target: TUBA4A (Tubulin, alpha 4a (TUBA4A))

Reaktivität: Human, Maus, Ratte, Drosophila melanogaster, Arabidopsis, C. elegans

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TUBA4A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-TUBA4A Antikörper

Bindungsspezifität: Middle Region

Spezifität: Alpha Tubulin 4 A antibody was raised against the middle region of TUBA4

Aufreinigung: Affinity purified

Immunogen: alpha Tubulin 4 A antibody was raised using the middle region of TUBA4 corresponding to a region with amino acids GGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTH

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

alpha Tubulin 4A Blocking Peptide, (ABIN938687), is also available for use as a blocking control in assays to test for specificity of this alpha Tubulin 4A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TUBA0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TUBA4A

Target: TUBA4A (Tubulin, alpha 4a (TUBA4A))

Andere Bezeichnung: alpha Tubulin 4A

Hintergrund: Microtubules of the eukaryotic cytoskeleton perform essential and diverse functions and are composed of a heterodimer of alpha and beta tubulin. The genes encoding these microtubule constituents are part of the tubulin superfamily.

Molekulargewicht: 50 kDa (MW of target protein)

Pathways: Microtubule Dynamics, M Phase