KDM4B Antikörper (Middle Region)
-
- Target Alle KDM4B Antikörper anzeigen
- KDM4B (Lysine (K)-Specific Demethylase 4B (KDM4B))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser KDM4B Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- JMJD2 B antibody was raised against the middle region of JMJD2
- Aufreinigung
- Affinity purified
- Immunogen
- JMJD2 B antibody was raised using the middle region of JMJD2 corresponding to a region with amino acids SASRASLKAKLLRRSHRKRSQPKKPKPEDPKFPGEGTAGAALLEEAGGSV
- Top Product
- Discover our top product KDM4B Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
JMJD2B Blocking Peptide, catalog no. 33R-8316, is also available for use as a blocking control in assays to test for specificity of this JMJD2B antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of JMJD0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KDM4B (Lysine (K)-Specific Demethylase 4B (KDM4B))
- Andere Bezeichnung
- JMJD2B (KDM4B Produkte)
- Hintergrund
- JMJD2 family proteins are classified into one group with JD2H and TUDOR domains and another group without JD2H or TUDOR domains. Because JMJD2C gene (also known as GASC1 gene) is amplified in esophageal squamous cell carcinoma (ESCC), JMJD2 family genes are cancer-associated genes.
- Molekulargewicht
- 122 kDa (MW of target protein)
- Pathways
- Warburg Effekt
-