GALE Antikörper (N-Term)

Produktnummer ABIN631451

Produktdetails anti-GALE Antikörper

Target: GALE (UDP-Galactose-4-Epimerase (GALE))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GALE Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: GALE antibody was raised against the N terminal of GALE

Aufreinigung: Affinity purified

Immunogen: GALE antibody was raised using the N terminal of GALE corresponding to a region with amino acids AEKVLVTGGAGYIGSHTVLELLEAGYLPVVIDNFHNAFRGGGSLPESLRR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GALE Blocking Peptide, catalog no. 33R-1135, is also available for use as a blocking control in assays to test for specificity of this GALE antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GALE antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GALE

Target: GALE (UDP-Galactose-4-Epimerase (GALE))

Andere Bezeichnung: GALE (GALE Produkte)

Synonyme: GALE antikoerper, im:7147391 antikoerper, wu:fb05f01 antikoerper, zgc:136578 antikoerper, F15H21.11 antikoerper, F15H21_11 antikoerper, REB1 antikoerper, ROOT EPIDERMAL BULGER1 antikoerper, ROOT HAIR DEFECTIVE 1 antikoerper, UDP-GLUCOSE 4-EPIMERASE antikoerper, UGE4 antikoerper, ECK0748 antikoerper, galD antikoerper, JW0742 antikoerper, SMU.888 antikoerper, BA5505 antikoerper, BA5700 antikoerper, VFA0352 antikoerper, galE antikoerper, 2310002A12Rik antikoerper, AI323962 antikoerper, 1n569 antikoerper, xgale antikoerper, SDR1E1 antikoerper, UDP-galactose-4-epimerase antikoerper, NAD(P)-binding Rossmann-fold superfamily protein antikoerper, UDP-galactose 4-epimerase GalE antikoerper, UDP-glucose 4-epimerase antikoerper, UDP-glucose 4-epimerase GalE antikoerper, UDP-glucose/UDP-N-acetylglucosamine 4-epimerase antikoerper, galactose-4-epimerase, UDP antikoerper, UDP-galactose-4-epimerase L homeolog antikoerper, GALE antikoerper, gale antikoerper, RHD1 antikoerper, ECs0787 antikoerper, galE antikoerper, galE1 antikoerper, galE2 antikoerper, STY0809 antikoerper, galE-2 antikoerper, SG0897 antikoerper, galD antikoerper, Ent638_1250 antikoerper, Gale antikoerper, gale.L antikoerper

Hintergrund: GALE is an UDP-galactose-4-epimerase which catalyzes two distinct but analogous reactions: the epimerization of UDP-glucose to UDP-galactose, and the epimerization of UDP-N-acetylglucosamine to UDP-N-acetylgalactosamine. The bifunctional nature of the enzyme has the important metabolic consequence that mutant cells (or individuals) are dependent not only on exogenous galactose, but also on exogenous N-acetylgalactosamine as a necessary precursor for the synthesis of glycoproteins and glycolipids. Mutations in this gene result in epimerase-deficiency galactosemia, also referred to as galactosemia type 3, a disease characterized by liver damage, early-onset cataracts, deafness and mental retardation.

Molekulargewicht: 38 kDa (MW of target protein)

Pathways: Response to Water Deprivation, Cellular Glucan Metabolic Process