GALE Antikörper (N-Term)

Produktnummer ABIN631451

Der Kaninchen Polyklonal Anti-GALE-Antikörper wurde für WB validiert. Er ist geeignet, GALE in Proben von Human zu detektieren.

Kurzübersicht für GALE Antikörper (N-Term) (ABIN631451)

Target: GALE (UDP-Galactose-4-Epimerase (GALE))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GALE Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-GALE Antikörper

Bindungsspezifität: N-Term

Spezifität: GALE antibody was raised against the N terminal of GALE

Aufreinigung: Affinity purified

Immunogen: GALE antibody was raised using the N terminal of GALE corresponding to a region with amino acids AEKVLVTGGAGYIGSHTVLELLEAGYLPVVIDNFHNAFRGGGSLPESLRR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GALE Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this GALE antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GALE antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GALE

Target: GALE (UDP-Galactose-4-Epimerase (GALE))

Andere Bezeichnung: GALE

Hintergrund: GALE is an UDP-galactose-4-epimerase which catalyzes two distinct but analogous reactions: the epimerization of UDP-glucose to UDP-galactose, and the epimerization of UDP-N-acetylglucosamine to UDP-N-acetylgalactosamine. The bifunctional nature of the enzyme has the important metabolic consequence that mutant cells (or individuals) are dependent not only on exogenous galactose, but also on exogenous N-acetylgalactosamine as a necessary precursor for the synthesis of glycoproteins and glycolipids. Mutations in this gene result in epimerase-deficiency galactosemia, also referred to as galactosemia type 3, a disease characterized by liver damage, early-onset cataracts, deafness and mental retardation.

Molekulargewicht: 38 kDa (MW of target protein)

Pathways: Response to Water Deprivation, Cellular Glucan Metabolic Process