ALG2 Antikörper

Produktnummer ABIN631449

Dieses Anti-ALG2-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von ALG2 in WB. Geeignet für Human, Maus und Ratte.

Kurzübersicht für ALG2 Antikörper (ABIN631449)

Target: ALG2 (Asparagine-Linked Glycosylation 2, alpha-1,3-Mannosyltransferase Homolog (ALG2))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ALG2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ALG2 Antikörper

Aufreinigung: Affinity purified

Immunogen: ALG2 antibody was raised using a synthetic peptide corresponding to a region with amino acids QSDLGQYVTFLRSFSDKQKISLLHSCTCVLYTPSNEHFGIVPLEAMYMQC

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ALG2 Blocking Peptide, (ABIN5612019), is also available for use as a blocking control in assays to test for specificity of this ALG2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALG2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ALG2

Target: ALG2 (Asparagine-Linked Glycosylation 2, alpha-1,3-Mannosyltransferase Homolog (ALG2))

Andere Bezeichnung: ALG2

Hintergrund: ALG2 is a member of the glycosyltransferase 1 family. It acts as an alpha 1,3 mannosyltransferase, mannosylating Man(2)GlcNAc(2)-dolichol diphosphate and Man(1)GlcNAc(2)-dolichol diphosphate to form Man(3)GlcNAc(2)-dolichol diphosphate. Defects in this gene have been associated with congenital disorder of glycosylation type Ih (CDG-Ii).

Molekulargewicht: 47 kDa (MW of target protein)