PAPSS2 Antikörper (C-Term)

Produktnummer ABIN631448

Produktdetails anti-PAPSS2 Antikörper

Target: PAPSS2 (3'-phosphoadenosine 5'-phosphosulfate Synthase 2 (PAPSS2))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PAPSS2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PAPSS2 antibody was raised against the C terminal of PAPSS2

Aufreinigung: Affinity purified

Immunogen: PAPSS2 antibody was raised using the C terminal of PAPSS2 corresponding to a region with amino acids PARHNEFDFISGTRMRKLAREGENPPDGFMAPKAWKVLTDYYRSLEKN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PAPSS2 Blocking Peptide, catalog no. 33R-6976, is also available for use as a blocking control in assays to test for specificity of this PAPSS2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PAPSS2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PAPSS2

Target: PAPSS2 (3'-phosphoadenosine 5'-phosphosulfate Synthase 2 (PAPSS2))

Andere Bezeichnung: PAPSS2 (PAPSS2 Produkte)

Synonyme: ATPSK2 antikoerper, BCYM4 antikoerper, SK2 antikoerper, 1810018P12Rik antikoerper, AI159688 antikoerper, AtpsU2 antikoerper, Atpsk2 antikoerper, Sk2 antikoerper, bm antikoerper, Papss1 antikoerper, id:ibd2761 antikoerper, papss2 antikoerper, sb:cb868 antikoerper, wu:fb12e05 antikoerper, zgc:55851 antikoerper, zgc:85655 antikoerper, PAPSS2 antikoerper, zgc:153748 antikoerper, 3'-phosphoadenosine 5'-phosphosulfate synthase 2 antikoerper, 3'-phosphoadenosine 5'-phosphosulfate synthase 2b antikoerper, 3'-phosphoadenosine 5'-phosphosulfate synthase 2a antikoerper, PAPSS2 antikoerper, Papss2 antikoerper, papss2b antikoerper, papss2.S antikoerper, LOAG_05620 antikoerper, papss2 antikoerper, papss2a antikoerper

Hintergrund: Sulfation is a common modification of endogenous (lipids, proteins, and carbohydrates) and exogenous (xenobiotics and drugs) compounds. In mammals, the sulfate source is 3'-phosphoadenosine 5'-phosphosulfate (PAPS), created from ATP and inorganic sulfate. Two different tissue isoforms encoded by different genes synthesize PAPS. PAPSS2 is one of the two PAPS synthetases. Defects in this gene cause the Pakistani type of spondyloepimetaphyseal dysplasia.

Molekulargewicht: 70 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process, Ribonucleoside Biosynthetic Process