Sec8 Antikörper (N-Term)

Produktnummer ABIN631432

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch Sec8 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für Sec8 Antikörper (N-Term) (ABIN631432)

Target: Sec8 (EXOC4) (Exocyst Complex Component 4 (EXOC4))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Sec8 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Sec8 Antikörper

Bindungsspezifität: N-Term

Spezifität: EXOC4 antibody was raised against the N terminal of EXOC4

Aufreinigung: Affinity purified

Immunogen: EXOC4 antibody was raised using the N terminal of EXOC4 corresponding to a region with amino acids MAAEAAGGKYRSTVSKSKDPSGLLISVIRTLSTSDDVEDRENEKGRLEEA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

EXOC4 Blocking Peptide, (ABIN5613427), is also available for use as a blocking control in assays to test for specificity of this EXOC4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EXOC4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Sec8

Target: Sec8 (EXOC4) (Exocyst Complex Component 4 (EXOC4))

Andere Bezeichnung: EXOC4

Hintergrund: The protein encoded by this gene is a component of the exocyst complex, a multiple protein complex essential for targeting exocytic vesicles to specific docking sites on the plasma membrane. Though best characterized in yeast, the component proteins and functions of exocyst complex have been demonstrated to be highly conserved in higher eukaryotes.

Molekulargewicht: 54 kDa (MW of target protein)

Pathways: Peptide Hormone Metabolism, Synaptic Vesicle Exocytosis