RNF168 Antikörper (C-Term)
-
- Target Alle RNF168 Antikörper anzeigen
- RNF168 (Ring Finger Protein 168 (RNF168))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Maus, Ratte, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RNF168 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- RNF168 antibody was raised against the C terminal of RNF168
- Aufreinigung
- Affinity purified
- Immunogen
- RNF168 antibody was raised using the C terminal of RNF168 corresponding to a region with amino acids PCFSAKRRKVSPESSPDQEETEINFTQKLIDLEHLLFERHKQEEQDRLLA
- Top Product
- Discover our top product RNF168 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RNF168 Blocking Peptide, catalog no. 33R-6996, is also available for use as a blocking control in assays to test for specificity of this RNF168 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF168 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RNF168 (Ring Finger Protein 168 (RNF168))
- Andere Bezeichnung
- RNF168 (RNF168 Produkte)
- Synonyme
- 3110001H15Rik antikoerper, hRNF168 antikoerper, ring finger protein 168 antikoerper, ring finger protein 168, E3 ubiquitin protein ligase L homeolog antikoerper, Rnf168 antikoerper, rnf168.L antikoerper, RNF168 antikoerper
- Hintergrund
- The complex repair response elicited by DNA double-strand breaks (DSBs) includes recruitment of several DNA repair proteins and ubiquitination of H2A-type histones. RNF168 is an E3 ubiquitin ligase critical for DSB repair.
- Molekulargewicht
- 65 kDa (MW of target protein)
- Pathways
- Production of Molecular Mediator of Immune Response
-