RNF168 Antikörper (C-Term)

Produktnummer ABIN631390

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch RNF168 in WB und IHC. Er zeigt eine Reaktivität gegenüber Human, Maus, Hund und Ratte.

Kurzübersicht für RNF168 Antikörper (C-Term) (ABIN631390)

Target: RNF168 (Ring Finger Protein 168 (RNF168))

Reaktivität: Human, Maus, Hund, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RNF168 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-RNF168 Antikörper

Bindungsspezifität: C-Term

Spezifität: RNF168 antibody was raised against the C terminal of RNF168

Aufreinigung: Affinity purified

Immunogen: RNF168 antibody was raised using the C terminal of RNF168 corresponding to a region with amino acids PCFSAKRRKVSPESSPDQEETEINFTQKLIDLEHLLFERHKQEEQDRLLA

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RNF168 Blocking Peptide, (ABIN5615894), is also available for use as a blocking control in assays to test for specificity of this RNF168 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF168 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RNF168

Target: RNF168 (Ring Finger Protein 168 (RNF168))

Andere Bezeichnung: RNF168

Hintergrund: The complex repair response elicited by DNA double-strand breaks (DSBs) includes recruitment of several DNA repair proteins and ubiquitination of H2A-type histones. RNF168 is an E3 ubiquitin ligase critical for DSB repair.

Molekulargewicht: 65 kDa (MW of target protein)

Pathways: Production of Molecular Mediator of Immune Response