WWP2 Antikörper (Middle Region)

Produktnummer ABIN631357

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch WWP2 in WB und IHC. Es zeigt Reaktivität gegenüber Proben von Human, Maus und Hund.

Kurzübersicht für WWP2 Antikörper (Middle Region) (ABIN631357)

Target: WWP2 (WW Domain Containing E3 Ubiquitin Protein Ligase 2 (WWP2))

Reaktivität: Human, Maus, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser WWP2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-WWP2 Antikörper

Bindungsspezifität: Middle Region

Spezifität: WWP2 antibody was raised against the middle region of WWP2

Aufreinigung: Affinity purified

Immunogen: WWP2 antibody was raised using the middle region of WWP2 corresponding to a region with amino acids EMKYTSEGVRYFVDHNTRTTTFKDPRPGFESGTKQGSPGAYDRSFRWKYH

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

WWP2 Blocking Peptide, (ABIN937972), is also available for use as a blocking control in assays to test for specificity of this WWP2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WWP2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu WWP2

Target: WWP2 (WW Domain Containing E3 Ubiquitin Protein Ligase 2 (WWP2))

Andere Bezeichnung: WWP2

Hintergrund: WWP2 is a member of the NEDD4-like protein family. The family of proteins is known to possess ubiquitin-protein ligase activity. WWP2 contains 4 tandem WW domains. The WW domain is a protein motif consisting of 35 to 40 amino acids and is characterized by 4 conserved aromatic residues. The WW domain may mediate specific protein-protein interactions.

Molekulargewicht: 47 kDa (MW of target protein)

Pathways: Negative Regulation of Transporter Activity