WWP2 Antikörper (Middle Region)

Produktnummer ABIN631357

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch WWP2 in WB und IHC. Er zeigt eine Reaktivität gegenüber Human, Maus und Hund.

Kurzübersicht für WWP2 Antikörper (Middle Region) (ABIN631357)

Target: WWP2 (WW Domain Containing E3 Ubiquitin Protein Ligase 2 (WWP2))

Reaktivität: Human, Maus, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser WWP2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-WWP2 Antikörper

Bindungsspezifität: Middle Region

Spezifität: WWP2 antibody was raised against the middle region of WWP2

Aufreinigung: Affinity purified

Immunogen: WWP2 antibody was raised using the middle region of WWP2 corresponding to a region with amino acids EMKYTSEGVRYFVDHNTRTTTFKDPRPGFESGTKQGSPGAYDRSFRWKYH

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

WWP2 Blocking Peptide, (ABIN937972), is also available for use as a blocking control in assays to test for specificity of this WWP2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WWP2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu WWP2

Target: WWP2 (WW Domain Containing E3 Ubiquitin Protein Ligase 2 (WWP2))

Andere Bezeichnung: WWP2

Hintergrund: WWP2 is a member of the NEDD4-like protein family. The family of proteins is known to possess ubiquitin-protein ligase activity. WWP2 contains 4 tandem WW domains. The WW domain is a protein motif consisting of 35 to 40 amino acids and is characterized by 4 conserved aromatic residues. The WW domain may mediate specific protein-protein interactions.

Molekulargewicht: 47 kDa (MW of target protein)

Pathways: Negative Regulation of Transporter Activity