Nitrilase 1 Antikörper (N-Term)

Produktnummer ABIN631305

Dieses Anti-Nitrilase 1-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von Nitrilase 1 in WB. Geeignet für Human.

Kurzübersicht für Nitrilase 1 Antikörper (N-Term) (ABIN631305)

Target: Nitrilase 1 (NIT1)

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Nitrilase 1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Nitrilase 1 Antikörper

Bindungsspezifität: N-Term

Spezifität: NIT1 antibody was raised against the N terminal of NIT1

Aufreinigung: Affinity purified

Immunogen: NIT1 antibody was raised using the N terminal of NIT1 corresponding to a region with amino acids VREAARLGACLAFLPEAFDFIARDPAETLHLSEPLGGKLLEEYTQLAREC

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NIT1 Blocking Peptide, (ABIN5614998), is also available for use as a blocking control in assays to test for specificity of this NIT1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NIT1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Nitrilase 1

Target: Nitrilase 1 (NIT1)

Andere Bezeichnung: NIT1

Hintergrund: NIT1 play a role in cell growth and apoptosis: loss of expression promotes cell growth and resistance to DNA damage stress. NIT1 has tumor suppressor properties that enhances the apoptotic responsiveness in cancer cells.

Molekulargewicht: 36 kDa (MW of target protein)